class Kallisto < Formula desc "Quantify abundances of transcripts from RNA-Seq data" homepage "https://pachterlab.github.io/kallisto/" url "https://github.com/pachterlab/kallisto/archive/v0.46.1.tar.gz" sha256 "492ef081395e8858fcd9832aceb8b61c79358f00afb45e6709146c0fb51dd231" bottle do cellar :any sha256 "4c690ce6fff7b1fe564feffde0f2804eead80692a10af99ae568c880d0e7b748" => :catalina sha256 "5ef9fc208160c101e37c01b74216ec48c9d6d53d16dffee4e434d4db36e378da" => :mojave sha256 "199940d786f8092d549b3b66379a289966c37f51719c076d5c387dadbaeb1f81" => :high_sierra end depends_on "autoconf" => :build depends_on "automake" => :build depends_on "cmake" => :build depends_on "hdf5" def install # Upstream issue 15 Feb 2018 "cmake does not run autoreconf for htslib" # https://github.com/pachterlab/kallisto/issues/159 system "autoreconf", "-fiv", "ext/htslib" system "cmake", ".", *std_cmake_args # Upstream issue 15 Feb 2018 "parallelized build failure" # https://github.com/pachterlab/kallisto/issues/160 # Upstream issue 15 Feb 2018 "cannot use system htslib" # https://github.com/pachterlab/kallisto/issues/161 system "make", "htslib" system "make", "install" end test do (testpath/"test.fasta").write <<~EOS >seq0 FQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKF EOS output = shell_output("#{bin}/kallisto index -i test.index test.fasta 2>&1") assert_match "has 1 contigs and contains 32 k-mers", output end end