class Kallisto < Formula desc "Quantify abundances of transcripts from RNA-Seq data" homepage "https://pachterlab.github.io/kallisto/" url "https://github.com/pachterlab/kallisto/archive/v0.46.0.tar.gz" sha256 "af4778cf121cdb9f732b355fc0ce44c6708caddf22d9560ba7f4b5d5b9795be1" bottle do cellar :any sha256 "c60e52bbe6e9dea2457a3a9f716ce9f06263ed28ce42d232bd0368f47e3d7fff" => :mojave sha256 "efc5fc1be9d62856d14337c62849c75e666ee9eff4743b746a768f04ade695ff" => :high_sierra sha256 "0db682761ce6b5c22d02fb54afbc76d7e2cd8b4fe49798fa1422ad535dfedcc8" => :sierra end depends_on "autoconf" => :build depends_on "automake" => :build depends_on "cmake" => :build depends_on "hdf5" def install # Upstream issue 15 Feb 2018 "cmake does not run autoreconf for htslib" # https://github.com/pachterlab/kallisto/issues/159 system "autoreconf", "-fiv", "ext/htslib" system "cmake", ".", *std_cmake_args # Upstream issue 15 Feb 2018 "parallelized build failure" # https://github.com/pachterlab/kallisto/issues/160 # Upstream issue 15 Feb 2018 "cannot use system htslib" # https://github.com/pachterlab/kallisto/issues/161 system "make", "htslib" system "make", "install" end test do (testpath/"test.fasta").write <<~EOS >seq0 FQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKF EOS output = shell_output("#{bin}/kallisto index -i test.index test.fasta 2>&1") assert_match "has 1 contigs and contains 32 k-mers", output end end